PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG030184t1
Common NameTCM_030184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 289aa    MW: 32175.9 Da    PI: 5.516
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG030184t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.21.8e-40101101101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkC+++C+lapyfpaeq++ f+n+hklFG+sn+lk+lk+l++ ++ +am+s+ y++++r + PvyG++gvi++lq q++ +++e
  Thecc1EG030184t1  10 ACAACKYQRRKCTPECPLAPYFPAEQARVFQNAHKLFGVSNILKILKNLNPAQQAEAMRSIKYQSNVRDQFPVYGCLGVIRQLQYQIQLVEEE 102
                       7******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       l++++++l
  Thecc1EG030184t1 103 LHAVHAQL 110
                       ***99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1239110IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MTLKGGTASA CAACKYQRRK CTPECPLAPY FPAEQARVFQ NAHKLFGVSN ILKILKNLNP  60
AQQAEAMRSI KYQSNVRDQF PVYGCLGVIR QLQYQIQLVE EELHAVHAQL EMYRQHHQIS  120
SIADDVPSQL ELGMAPPSNA LPLFNQVPQQ HYNSLAALPV SMQHSYSNSS NVDYSSSYMD  180
SKENVANSLW VQHPFAKNNN TDNGSTMAIQ SQLVAPQTVA VQQQVVQDYD EIHPFFDAID  240
DRQSYIDSKE PYESSSEESL KDTTQSVEHV AENELKSAAA CFSLTSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026014.10.0LOB domain-containing protein, putative
SwissprotQ9STS61e-64LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A061GGF80.0A0A061GGF8_THECC; LOB domain-containing protein, putative
STRINGPOPTR_0012s07390.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-57LOB domain-containing protein 27
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]